-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLP1R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLP1R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glp1r |
| Target Synonyms | GLP-1; GLP-1R; GLP-1-R; GLP1R | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNS | Uniprot ID | P43220 |
Uniprot Id
P43220
Target Species
Human
Target Name
GLP1R
Target Full Name
Glucagon-like peptide 1 receptor
Target Function
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Research Area
Neuroscience, Cardiovascular
Target Synonyms
GLP1R; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Target Background
This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
Notification