Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPLD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GPLD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02929A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPLD1 |
| Target Synonyms | PLD; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; GPLD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSA | Uniprot ID | P80108 |
Uniprot Id
P80108
Target Species
Human
Target Name
GPLD1
Target Full Name
Phosphatidylinositol-glycan-specific phospholipase D
Target Function
This protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.
Target Subcellular Location
Secreted.
Target Protein Families
GPLD1 family
Target Synonyms
Glycoprotein phospholipase D; Glycosyl-phosphatidylinositol-specific phospholipase D; GPI-PLD; GPI-specific phospholipase D; GPIPLD; GPIPLDM; GPLD1; MGC22590; PHLD_HUMAN; Phosphatidylinositol glycan specific phospholipase D; Phosphatidylinositol-glycan-specific phospholipase D; PI-G PLD; PIGPLD; PIGPLD1
Target Background
Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
