Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human GPX7 (NP_056511.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human GPX7 (NP_056511.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11234A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPX7 |
| Target Synonyms | GPX6; CL683; GPx-7; NPGPx; GSHPx-7; GPX7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, LO2, Mouse brain, SW480, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human GPX7 (NP_056511.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL | Uniprot ID | Q96SL4 |
Uniprot Id
Q96SL4
Target Species
Human
Target Name
GPX7
Target Full Name
Glutathione peroxidase 7
Target Function
It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.
Target Involvement
Barrett esophagus (BE)
Target Subcellular Location
Secreted.
Target Protein Families
Glutathione peroxidase family
Target Tissue Specificity
Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids.
Target Synonyms
CL683; FLJ14777; Glutathione peroxidase 7; GPx-7; GPX6; GPX7; GPX7_HUMAN; GSHPx-7; NPGPx
Target Background
Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
