-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRIK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRIK2 (Q13002) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GRIK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRIK2 (Q13002) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14210A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRIK2 |
| Target Synonyms | EAA4; GLR6; MRT6; GLUK6; GLUR6; GluK2; NEDLAS; GRIK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRIK2 (Q13002). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY | Uniprot ID | Q13002 |
Uniprot Id
Q13002
Target Species
Human
Target Name
GRIK2
Target Full Name
Glutamate receptor ionotropic, kainate 2
Target Function
Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. Modulates cell surface expression of NETO2.; Independent of its ionotropic glutamate receptor activity, acts as a thermoreceptor conferring sensitivity to cold temperatures. Functions in dorsal root ganglion neurons.
Target Involvement
Mental retardation, autosomal recessive 6 (MRT6)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRIK2 subfamily
Target Tissue Specificity
Expression is higher in cerebellum than in cerebral cortex.
Target Synonyms
bA487F5.1; EAA4; Excitatory amino acid receptor 4; GLR 6; GLR6; GluK2; GLUK6; GLUR 6; GluR-6; GluR6; Glutamate receptor 6; Glutamate receptor; glutamate receptor form A; glutamate receptor form B; glutamate receptor form C; glutamate receptor form D; glutamate receptor form E; Glutamate receptor ionotropic kainate 2; GRIK 2; GRIK2; GRIK2 protein; GRIK2_HUMAN; ionotropic kainate 2; MRT6
Target Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive cognitive disability.
Notification