-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-170 of human GRM3 (NP_000831.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-170 of human GRM3 (NP_000831.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04333A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRM3 |
| Target Synonyms | GLUR3; mGlu3; GPRC1C; MGLUR3; GRM3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-170 of human GRM3 (NP_000831.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQIS | Uniprot ID | Q14832 |
Uniprot Id
Q14832
Target Species
Human
Target Name
GRM3
Target Full Name
Metabotropic glutamate receptor 3
Target Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 3 family
Target Tissue Specificity
Detected in brain cortex, thalamus, subthalamic nucleus, substantia nigra, hypothalamus, hippocampus, corpus callosum, caudate nucleus and amygdala.
Target Synonyms
GLUR3; Glutamate metabotropic receptor 3; Glutamate receptor metabotropic 3; GPRC1C; GRM3; GRM3_HUMAN; Metabotropic glutamate receptor 3; MGlu3; mGluR3
Target Background
L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.
Notification