-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GTF2A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human GTF2A2 (NP_004483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GTF2A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human GTF2A2 (NP_004483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02376A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GTF2A2 |
| Target Synonyms | TF2A2; TFIIA; T18745; TFIIAS; HsT18745; TFIIA-12; TFIIA-gamma; GTF2A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-109 of human GTF2A2 (NP_004483.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE | Uniprot ID | P52657 |
Uniprot Id
P52657
Target Species
Human
Target Name
GTF2A2
Target Full Name
Transcription initiation factor IIA subunit 2
Target Function
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Target Subcellular Location
Nucleus.
Target Protein Families
TFIIA subunit 2 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
General transcription factor IIA; General transcription factor IIA subunit 2; General transcription factor IIA; 2 (12kD subunit); General transcription factor IIA; 2; 12kDa; gtf2a2; HsT18745; T2AG_HUMAN; TF2A2; TFIIA 12; TFIIA; TFIIA gamma ; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIA12; TFIIAS; Transcription initiation factor IIA gamma chain; Transcription initiation factor IIA subunit 2
Target Background
Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).
Notification