-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GUCA1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GUCA1B (NP_002089.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GUCA1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GUCA1B (NP_002089.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05481A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GUCA1B |
| Target Synonyms | RP48; GCAP2; GUCA2; GCAP 2; GUCA1B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GUCA1B (NP_002089.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF | Uniprot ID | Q9UMX6 |
Uniprot Id
Q9UMX6
Target Species
Human
Target Name
GUCA1B
Target Full Name
Guanylyl cyclase-activating protein 2
Target Function
Stimulates two retinal guanylyl cyclases (GCs) GUCY2D and GUCY2F when free calcium ions concentration is low, and inhibits GUCY2D and GUCY2F when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GCs is a key event in recovery of the dark state of rod photoreceptors following light exposure. May be involved in cone photoreceptor response and recovery of response in bright light.
Target Involvement
Retinitis pigmentosa 48 (RP48)
Target Subcellular Location
Cell membrane; Lipid-anchor. Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment.
Target Tissue Specificity
In the retina, it is expressed in cone and rod photoreceptor cells.
Target Synonyms
GCAP 2; Guanylate Cyclase Activating Protein Photoreceptor 2; Guanylate cyclase activator 1B; Guanylin 2; Guanylyl cyclase-activating protein 2; GUC1B_HUMAN; GUCA 2; Guca1b
Target Background
The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
Notification