Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GULP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GULP1 (NP_057399.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GULP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GULP1 (NP_057399.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04119A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GULP1 |
| Target Synonyms | CED6; GULP; CED-6; GULP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HT-29, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GULP1 (NP_057399.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDS | Uniprot ID | Q9UBP9 |
Uniprot Id
Q9UBP9
Target Species
Human
Target Name
GULP1
Target Full Name
PTB domain-containing engulfment adapter protein 1
Target Function
May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6.
Target Subcellular Location
Cytoplasm. Note=May associate with the cytoplasmic side of the plasma membrane and early endosomes.
Target Protein Families
Ced-6 family
Target Tissue Specificity
Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary.
Target Synonyms
CED6; Cell death protein 6 homolog; Engulfment adapter protein; Engulfment adaptor PTB domain containing 1; GULP; GULP; engulfment adaptor PTB domain containing 1; GULP1; GULP1_HUMAN; Protein GULP; PTB domain adapter protein CED 6; PTB domain adapter protein CED-6; PTB domain adaptor protein CED6; PTB domain-containing engulfment adapter protein 1
Target Background
The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
