-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HBB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 47-147 of human HBB (NP_000509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HBB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 47-147 of human HBB (NP_000509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09607A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HBB |
| Target Synonyms | ECYT6; CD113t-C; beta-globin; HBB | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 47-147 of human HBB (NP_000509.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Uniprot ID | P68871 |
Uniprot Id
P68871
Target Species
Human
Target Name
HBB
Target Full Name
Hemoglobin subunit beta
Target Function
Involved in oxygen transport from the lung to the various peripheral tissues.; LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure.; functions as an endogenous inhibitor of enkephalin-degrading enzymes such as DPP3, and as a selective antagonist of the P2RX3 receptor which is involved in pain signaling, these properties implicate it as a regulator of pain and inflammation.
Target Involvement
Heinz body anemias (HEIBAN); Beta-thalassemia (B-THAL); Sickle cell anemia (SKCA); Beta-thalassemia, dominant, inclusion body type (B-THALIB)
Target Protein Families
Globin family
Target Tissue Specificity
Red blood cells.
Target Synonyms
ECYT6; CD113t-C; beta-globin; HBB
Target Background
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Notification