Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HBG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1 (NP_000550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HBG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1 (NP_000550.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05327A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HBG1 |
| Target Synonyms | HBGA; HBGR; HBG-T2; HSGGL1; PRO2979; HBG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1 (NP_000550.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVD | Uniprot ID | P69891 |
Uniprot Id
P69891
Target Species
Human
Target Name
HBG1
Target Full Name
Hemoglobin subunit gamma-1
Target Function
Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Target Protein Families
Globin family
Target Tissue Specificity
Red blood cells.
Target Research Area
Signal Transduction
Target Synonyms
HBG1; PRO2979; Hemoglobin subunit gamma-1; Gamma-1-globin; Hb F Agamma; Hemoglobin gamma-1 chain; Hemoglobin gamma-A chain
Target Background
The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
