Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HCAR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HCAR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06403A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HCAR3 |
| Target Synonyms | HCA3; HM74; PUMAG; Puma-g; GPR109B; HCAR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-392 of human HCAR3 (NP_006009.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE | Uniprot ID | P49019 |
Uniprot Id
P49019
Target Species
Human
Target Name
HCAR3
Target Full Name
Hydroxycarboxylic acid receptor 3
Target Synonyms
HCAR3; GPR109B; HCA3; HM74B; NIACR2; Hydroxycarboxylic acid receptor 3; G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B; Niacin receptor 2; Nicotinic acid receptor 2
Target Background
Predicted to enable GTP binding activity and purinergic nucleotide receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in cell junction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
