-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HIF3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human HIF3A (NP_690008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HIF3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human HIF3A (NP_690008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06526A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HIF3A |
| Target Synonyms | IPAS; MOP7; PASD7; HIF-3A; bHLHe17; HIF3-alpha-1; HIF3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F-HIF3A-FlagN | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human HIF3A (NP_690008.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIF | Uniprot ID | Q9Y2N7 |
Uniprot Id
Q9Y2N7
Target Species
Human
Target Name
HIF3A
Target Full Name
Hypoxia-inducible factor 3-alpha
Target Function
Acts as a transcriptional regulator in adaptive response to low oxygen tension. Acts as a regulator of hypoxia-inducible gene expression. Functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. Plays a role in the development of the cardiorespiratory system. May also be involved in apoptosis.; Attenuates the ability of transcription factor HIF1A to bind to hypoxia-responsive elements (HRE) located within the enhancer/promoter of hypoxia-inducible target genes and hence inhibits HRE-driven transcriptional activation. Also inhibits hypoxia-inducible ARNT-mediated gene expression.; Attenuates the ability of transcription factor HIF1A to bind to hypoxia-responsive elements (HRE) located within the enhancer/promoter of hypoxia-inducible target genes and hence inhibits HRE-driven transcriptional activation.; Attenuates the ability of transcription factor HIF1A and EPAS1/HIF2A to bind to hypoxia-responsive elements (HRE) located within the enhancer/promoter of hypoxia-inducible target genes and hence inhibits HRE-driven transcriptional activation. May act as a tumor suppressor and inhibits malignant cell transformation.; Attenuates the ability of transcription factor HIF1A to bind to hypoxia-responsive elements (HRE) located within the enhancer/promoter of hypoxia-inducible target genes and hence inhibits HRE-driven transcriptional activation.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus speckle. Mitochondrion.
Target Tissue Specificity
Expressed in vascular cells (at protein level). Expressed in kidney. Expressed in lung epithelial cells. Expressed in endothelial cells (venous and arterial cells from umbilical cord and aortic endothelial cells) and in vascular smooth muscle cells (aorta
Target Synonyms
Basic-helix-loop-helix-PAS protein MOP7; bHLHe17; Class E basic helix-loop-helix protein 17; HIF 3A; HIF 3A4; HIF-3-alpha; HIF3 alpha; HIF3-alpha; HIF3-alpha-1; HIF3A; HIF3A_HUMAN; Hypoxia Inducible Factor 3 alpha; Hypoxia inducible factor 3 alpha subunit; Hypoxia inducible factor three alpha ; Hypoxia-inducible factor 3-alpha; Inhibitory PAS domain protein; IPAS; Member of PAS protein 7; MOP7; PAS domain-containing protein 7; PASD7
Target Background
The protein encoded by this gene is the alpha-3 subunit of one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha-3 subunit lacks the transactivation domain found in factors containing either the alpha-1 or alpha-2 subunits. It is thought that factors containing the alpha-3 subunit are negative regulators of hypoxia-inducible gene expression. Multiple alternatively spliced transcript variants have been found for this gene.
Notification