-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB3 (NP_005333.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HMGB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB3 (NP_005333.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10146A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGB3 |
| Target Synonyms | HMG4; HMG-4; HMG2A; HMG-2a; HMGB3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB3 (NP_005333.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGF | Uniprot ID | O15347 |
Uniprot Id
O15347
Target Species
Human
Target Name
HMGB3
Target Full Name
High mobility group protein B3
Target Function
Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters. Proposed to be involved in the innate immune response to nucleic acids by acting as a cytoplasmic promiscuous immunogenic DNA/RNA sensor. Negatively regulates B-cell and myeloid cell differentiation. In hematopoietic stem cells may regulate the balance between self-renewal and differentiation. Involved in negative regulation of canonical Wnt signaling.
Target Involvement
Microphthalmia, syndromic, 13 (MCOPS13)
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm.
Target Protein Families
HMGB family
Target Tissue Specificity
Expressed predominantly in placenta.
Target Synonyms
chromosomal protein; Nonhistone; HMG4; High mobility group (nonhistone chromosomal) protein 4; High mobility group box 3 ; High mobility group protein 2a; High mobility group protein 4; High mobility group protein B3; High mobility group protein HMG4 ; HMG 4 ; HMG-2a; HMG-4; HMG2A; HMGB 3 ; Hmgb3; HMGB3_HUMAN; MGC90319; Non histone chromosomal protein; Nonhistone chromosomal protein HMG4
Target Background
This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Notification