Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNF4G5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 319-408 of human HNF4G5 (NP_004124.4?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HNF4G5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 319-408 of human HNF4G5 (NP_004124.4?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of lysates from 22Rv1 cells, using HNF4G5 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-15560A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNF4G5 |
| Target Synonyms | NR2A2; NR2A3; HNF4G5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 319-408 of human HNF4G5 (NP_004124.4?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL | Uniprot ID | Q14541 |
Uniprot Id
Q14541
Target Species
Human
Target Name
HNF4G
Target Full Name
Hepatocyte nuclear factor 4-gamma
Target Function
Transcription factor. Has a lower transcription activation potential than HNF4-alpha.
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Tissue Specificity
Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.
Target Synonyms
HNF4G; NR2A2Hepatocyte nuclear factor 4-gamma; HNF-4-gamma; Nuclear receptor subfamily 2 group A member 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
