-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRNPDL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 261-420 of human HNRNPDL (NP_112740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HNRNPDL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 261-420 of human HNRNPDL (NP_112740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08670A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRNPDL |
| Target Synonyms | HNRNP; JKTBP; HNRPDL; JKTBP2; LGMD1G; LGMDD3; laAUF1; HNRNPDL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Jurkat, Mouse brain, Mouse testis, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 261-420 of human HNRNPDL (NP_112740.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY | Uniprot ID | O14979 |
Uniprot Id
O14979
Target Species
Human
Target Name
HNRNPDL
Target Full Name
Heterogeneous nuclear ribonucleoprotein D-like
Target Function
Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes. Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter. Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.
Target Involvement
Limb-girdle muscular dystrophy 1G (LGMD1G)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Expressed in myeloid leukemia, gastric adenocarcinoma, cervical carcinoma, hepatoma, fibro
Target Synonyms
A+U-rich element RNA binding factor; AA407431; AA959857; AU rich element RNA binding factor; AU-rich element RNA-binding factor; D5Ertd650e; D5Wsu145e; Heterogeneous nuclear ribonucleoprotein D like; Heterogeneous nuclear ribonucleoprotein D like protein; Heterogeneous nuclear ribonucleoprotein D-like; hnHNRP DL; HNRDL_HUMAN; HNRNP; hnRNP D-like; hnRNP DL; HNRNPDL; hnRPD like protein; JKT41 binding protein; JKT41-binding protein; JKTBP; JKTBP2; laAUF1; MGC125262; Protein laAUF1
Target Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD.
Notification