-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HNRNPM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human HNRNPM (P52272) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HNRNPM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human HNRNPM (P52272) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13482A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HNRNPM |
| Target Synonyms | CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M; HNRNPM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Jurkat, Mouse liver, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human HNRNPM (P52272). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG | Uniprot ID | P52272 |
Uniprot Id
P52272
Target Species
Human
Target Name
HNRNPM
Target Full Name
Heterogeneous nuclear ribonucleoprotein M
Target Function
Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines.
Target Subcellular Location
Nucleus, nucleolus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CEA receptor; CEAR; Heterogeneous nuclear ribonucleoprotein M; Heterogenous nuclear ribonucleoprotein M4; hnRNA binding protein M4; hnRNP M; Hnrnpm; HNRNPM4; HNRPM; HNRPM_HUMAN; HNRPM4; HTGR1; M3; M4; M4 protein; N-acetylglucosamine receptor 1; NAGR1
Target Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Alternative splicing results in multiple transcript variants.
Notification