Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HOXB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09453A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXB1 |
| Target Synonyms | HOX2; HCFP3; HOX2I; Hox-2.9; HOXB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human HOXB1 (NP_002135.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF | Uniprot ID | P14653 |
Uniprot Id
P14653
Target Species
Human
Target Name
HOXB1
Target Full Name
Homeobox protein Hox-B1
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
Target Involvement
Facial paresis, hereditary congenital, 3 (HCFP3)
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family, Labial subfamily
Target Synonyms
HCFP3; Homeo box 2I; Homeo box B1; Homeobox 2I; Homeobox B1; Homeobox protein Hox B1; Homeobox protein Hox-2I; Homeobox protein Hox-B1; Homeobox protein HoxB1; Homeobox2I; HomeoboxB1; HOX 2; Hox 2.9; HOX 2I; HOX B1; HOX2; Hox2.9; HOX2I; HOXB 1; HOXB1; HOXB1 protein; HXB1_HUMAN; MGC116843; MGC116844; MGC116845
Target Background
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
