Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HOXB7 (NP_004493.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HOXB7 (NP_004493.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02788A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXB7 |
| Target Synonyms | HOX2; HOX2C; HHO.C1; Hox-2.3; HOXB7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HOXB7 (NP_004493.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA | Uniprot ID | P09629 |
Uniprot Id
P09629
Target Species
Human
Target Name
HOXB7
Target Full Name
Homeobox protein Hox-B7
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family
Target Synonyms
HOXB7; HOX2C; Homeobox protein Hox-B7; Homeobox protein HHO.C1; Homeobox protein Hox-2C
Target Background
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
