Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HPCAL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human HPCAL1 (NP_002140.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against HPCAL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human HPCAL1 (NP_002140.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-07716A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HPCAL1 |
| Target Synonyms | BDR1; HLP2; VILIP-3; HPCAL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human HPCAL1 (NP_002140.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF | Uniprot ID | P37235 |
Uniprot Id
P37235
Target Species
Human
Target Name
HPCAL1
Target Full Name
Hippocalcin-like protein 1
Target Function
May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.
Target Subcellular Location
Membrane; Lipid-anchor.
Target Protein Families
Recoverin family
Target Synonyms
BDR1; Calcium binding protein BDR1; Calcium-binding protein BDR-1; hippocalcin like 1; Hippocalcin-like protein 1; HLP2; HPCAL1; HPCAL1 protein; HPCL1_HUMAN; REM-1; VILIP-3; Visinin like protein 3; Visinin-like protein 3
Target Background
The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
