-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HRH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human HRH1 (NP_000852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HRH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human HRH1 (NP_000852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HRH1 |
| Target Synonyms | H1R; H1-R; HH1R; hisH1; HRH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human HRH1 (NP_000852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNT | Uniprot ID | P35367 |
Uniprot Id
P35367
Target Species
Human
Target Name
HRH1
Target Full Name
Histamine H1 receptor
Target Function
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
BPHS, mouse, homolog of; H1 R; H1R; HH1R; HisH1; Histamine H(1) receptor; Histamine H1 receptor; Histamine receptor H1; Histamine receptor subclass H1; Hrh1; HRH1_HUMAN
Target Background
Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. It has been associated with multiple processes, including memory and learning, circadian rhythm, and thermoregulation. It is also known to contribute to the pathophysiology of allergic diseases such as atopic dermatitis, asthma, anaphylaxis and allergic rhinitis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification