Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HTR1F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HTR1F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05476A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HTR1F |
| Target Synonyms | 5HT6; MR77; 5-HT1F; HTR1EL; 5-HT-1F; HTR1F | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERK | Uniprot ID | P30939 |
Uniprot Id
P30939
Target Species
Human
Target Name
HTR1F
Target Full Name
5-hydroxytryptamine receptor 1F
Target Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
HTR1F; HTR1EL; 5-hydroxytryptamine receptor 1F; 5-HT-1F; 5-HT1F; Serotonin receptor 1F
Target Background
Enables G protein-coupled serotonin receptor activity and serotonin binding activity. Involved in adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway. Is integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
