Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HYI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-260 of human HYI (NP_001177809.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HYI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-260 of human HYI (NP_001177809.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03248A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HYI |
| Target Synonyms | HT036; HYI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-260 of human HYI (NP_001177809.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGL | Uniprot ID | Q5T013 |
Uniprot Id
Q5T013
Target Species
Human
Target Name
HYI
Target Full Name
Putative hydroxypyruvate isomerase
Target Function
Catalyzes the reversible isomerization between hydroxypyruvate and 2-hydroxy-3-oxopropanoate (also termed tartronate semialdehyde).
Target Protein Families
Hyi family
Target Synonyms
Endothelial cell apoptosis protein E CE1; Endothelial cell apoptosis protein E-CE1; HT036; Hydroxypyruvate isomerase; Hydroxypyruvate isomerase homolog (E. coli); Hydroxypyruvate isomerase homolog; hyi; HYI_HUMAN; MGC20767; Putative hydroxypyruvate isomerase; RP11 506B15.5
Target Background
This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
