-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ID2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ID2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10886A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ID2 |
| Target Synonyms | GIG8; ID2A; ID2H; bHLHb26; ID2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG | Uniprot ID | Q02363 |
Uniprot Id
Q02363
Target Species
Human
Target Name
ID2
Target Full Name
DNA-binding protein inhibitor ID-2
Target Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Highly expressed in early fetal tissues, including those of the central nervous system.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
bHLHb26; Cell growth inhibiting gene 8; class B basic helix loop helix protein 26; Class B basic helix-loop-helix protein 26; DNA binding protein inhibitor ID 2; DNA binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG 8; GIG8; Helix loop helix protein ID2 ; ID2; ID2_HUMAN; ID2A; ID2H; Inhibitor of differentiation 2; Inhibitor of DNA binding 2; Inhibitor of DNA binding 2, dominant negative helix loop helix protein; MGC26389
Target Background
The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3.
Notification