-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFIT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFIT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10277A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFIT2 |
| Target Synonyms | P54; G10P2; IFI54; ISG54; cig42; IFI-54; IFIT-2; ISG-54; GARG-39; IFI-54K; ISG-54K; ISG-54 K; IFIT2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE | Uniprot ID | P09913 |
Uniprot Id
P09913
Target Species
Human
Target Name
IFIT2
Target Full Name
Interferon-induced protein with tetratricopeptide repeats 2
Target Function
IFN-induced antiviral protein which inhibits expression of viral messenger RNAs lacking 2'-O-methylation of the 5' cap. The ribose 2'-O-methylation would provide a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Binds AU-rich viral RNAs, with or without 5' triphosphorylation, RNA-binding is required for antiviral activity. Can promote apoptosis.
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum.
Target Protein Families
IFIT family
Target Synonyms
CIG-42; cig42; G10P2; GARG 39 ; Glucocorticoid attenuated response gene 39; IFI 54 ; IFI 54K ; IFI-54K; IFI54 ; IFIT 2; IFIT-2; IFIT2; IFIT2_HUMAN; Interferon induced 54 kDa protein ; Interferon induced protein 54 ; Interferon induced protein with tetratricopeptide repeats 2; Interferon, alpha inducible protein (MW 54kD); Interferon-induced 54 kDa protein; Interferon-induced protein with tetratricopeptide repeats 2; ISG 54 K; ISG 54K; ISG-54 K; ISG54
Target Background
Enables RNA binding activity. Involved in negative regulation of protein binding activity; positive regulation of apoptotic process; and response to virus. Located in endoplasmic reticulum.
Notification