Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGFBPL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human IGFBPL1 (NP_001007564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IGFBPL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human IGFBPL1 (NP_001007564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00156A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGFBPL1 |
| Target Synonyms | IGFBPRP4; IGFBP-RP4; bA113O24.1; IGFBPL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human IGFBPL1 (NP_001007564.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVG | Uniprot ID | Q8WX77 |
Uniprot Id
Q8WX77
Target Species
Human
Target Name
IGFBPL1
Target Full Name
Insulin-like growth factor-binding protein-like 1
Target Function
IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors. May be a putative tumor suppressor protein.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed at the highest level in both brain and testis, with lower levels in the prostate, bladder and lung.
Target Synonyms
IGFBPL1; IGFBPRP4Insulin-like growth factor-binding protein-like 1; IGFBP-related protein 10; Insulin-like growth factor-binding-related protein 4; IGFBP-rP4
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
