Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL12A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL12A (NP_000873.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL12A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL12A (NP_000873.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08760A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL12A |
| Target Synonyms | P35; CLMF; NFSK; NKSF1; IL-12A; IL12A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | RAW264.7, Recombinant Human IL12A/NKSF1 Protein | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IL12A (NP_000873.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKT | Uniprot ID | P29459 |
Uniprot Id
P29459
Target Species
Human
Target Name
IL12A
Target Full Name
Interleukin-12 subunit alpha
Target Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Target Subcellular Location
Secreted.
Target Protein Families
IL-6 superfamily
Target Research Area
Cancer
Target Synonyms
CLMF; CLMF p35; CLMF p40; CLMF1; CLMF2; Cytotoxic lymphocyte maturation factor 1, p35; Cytotoxic lymphocyte maturation factor 2; Cytotoxic lymphocyte maturation factor 35 kDa subunit; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12A; IL 2 subunit p40; IL-12 subunit p35; IL-12A; IL-12B; IL12; IL12, p35 subunit; IL12, subunit p40; IL12A; IL12A_HUMAN; IL12B; IL35 subunit; Interleukin 12 alpha chain; Interleukin 12 beta chain; Interleukin 12 subunit beta; Interleukin 12, p40; Interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); Interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); Interleukin 12B; Interleukin-12 subunit alpha; Natural killer cell stimulatory factor 1, 35 kD subunit; natural killer cell stimulatory factor 2; Natural killer cell stimulatory factor, 40 kD subunit; NF cell stimulatory factor chain 1; NFSK; NK cell stimulatory factor chain 1; NK cell stimulatory factor chain 2; NKSF; NKSF1; NKSF2; P35
Target Background
This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
