Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL17RD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-300 of human IL17RD (NP_060033.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL17RD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-300 of human IL17RD (NP_060033.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01197A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL17RD |
| Target Synonyms | SEF; HH18; IL-17RD; IL17RLM; IL17RD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, HT-29, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-300 of human IL17RD (NP_060033.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTRKVMHYALKPVHSPWAGPIRA | Uniprot ID | Q8NFM7 |
Uniprot Id
Q8NFM7
Target Species
Human
Target Name
IL17RD
Target Full Name
Interleukin-17 receptor D
Target Function
Feedback inhibitor of fibroblast growth factor mediated Ras-MAPK signaling and ERK activation. Regulates the nuclear ERK signaling pathway by spatially blocking nuclear translocation of activated ERK without inhibiting cytoplasmic phosphorylation of ERK. Mediates JNK activation and may be involved in apoptosis. May inhibit FGF-induced FGFR1 tyrosine phosphorylation. Might have a role in the early stages of fate specification of GnRH-secreting neurons. Inhibits TGFB-induced epithelial-to-mesenchymal transition in lens epithelial cells.
Target Involvement
Hypogonadotropic hypogonadism 18 with or without anosmia (HH18)
Target Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Note=Predominantly associated with the Golgi apparatus and is partially translocated to the plasma membrane upon stimulation.; [Isoform 4]: Cytoplasm.
Target Tissue Specificity
Expressed in umbilical vein endothelial cells and in several highly vascularized tissues such as kidney, colon, skeletal muscle, heart and small intestine. Highly expressed in ductal epithelial cells of salivary glands, seminal vesicles and the collecting
Target Synonyms
DKFZp434N1928; FLJ35755; hSef; I17RD_HUMAN; IL 17 receptor D; IL 17RD; IL-17 receptor D; IL-17RD; IL17 receptor D; il17rd; IL17Rhom; IL17RLM; Interleukin 17 receptor D; Interleukin 17 receptor like protein; Interleukin-17 receptor D; Interleukin-17 receptor-like protein; Interleukin17 receptor D; MGC133309; SEF; Sef homolog
Target Background
This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not require the interleukin. The gene product also affects fibroblast growth factor signaling, inhibiting or stimulating growth through MAPK/ERK signaling. Alternate splicing generates multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
