Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL36R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human IL36R (NP_003845.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IL36R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human IL36R (NP_003845.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10892A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL36R |
| Target Synonyms | IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2; IL36R | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, K-562, MCF7, Mouse lung, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human IL36R (NP_003845.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKH | Uniprot ID | Q9HB29 |
Uniprot Id
Q9HB29
Target Species
Human
Target Name
IL1RL2
Target Full Name
Interleukin-1 receptor-like 2
Target Function
Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Interleukin-1 receptor family
Target Tissue Specificity
Expressed in synovial fibroblasts and articular chondrocytes. Expressed in keratinocytes and monocyte-derived dendritic cells. Expressed in monocytes and myeloid dendritic cells; at protein level.
Target Synonyms
IL 1 receptor related protein 2; IL 1Rrp2; IL 36R; IL-1Rrp2; IL-36 receptor; IL1 receptor related protein 2; IL1R rp2; IL1R-rp2; Il1rl2; IL1RRP2; IL36R; ILRL2_HUMAN; Interleukin 1 receptor like 2; Interleukin 1 receptor related protein 2; Interleukin-1 receptor-like 2; Interleukin-1 receptor-related protein 2
Target Background
The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
