-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITIH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-670 of human ITIH1 (NP_002206.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITIH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 530-670 of human ITIH1 (NP_002206.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01707A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITIH1 |
| Target Synonyms | H1P; ITIH; SHAP; IATIH; IGHEP1; ITI-HC1; ITIH1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, LO2, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 530-670 of human ITIH1 (NP_002206.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HGEGQEFSITCLVDEEEMKKLLRERGHMLENHVERLWAYLTIQELLAKRMKVDREERANLSSQALQMSLDYGFVTPLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVD | Uniprot ID | P19827 |
Uniprot Id
P19827
Target Species
Human
Target Name
ITIH1
Target Full Name
Inter-alpha-trypsin inhibitor heavy chain H1
Target Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.; Contains a potential peptide which could stimulate a broad spectrum of phagocytotic cells.
Target Subcellular Location
Secreted.
Target Protein Families
ITIH family
Target Synonyms
H1P; IATIH; IGHEP1; Inter alpha (globulin) inhibitor H1; Inter alpha (globulin) inhibitor H1 polypeptide; Inter alpha trypsin inhibitor heavy chain 1; Inter alpha trypsin inhibitor heavy chain H1; Inter-alpha-inhibitor heavy chain 1; Inter-alpha-trypsin inhibitor complex component III; Inter-alpha-trypsin inhibitor heavy chain H1; ITI heavy chain H1; ITI-HC1; ITIH; ITIH1; ITIH1_HUMAN; Serum-derived hyaluronan-associated protein; SHAP
Target Background
This gene encodes a member of the inter-alpha-trypsin inhibitor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the heavy chain of the inter-alpha-trypsin inhibitor complex, which is secreted by hepatocytes into the blood. The heavy chain also interacts with hyaluronan, and this interaction may play a role in ovulation and fertilization, and has been implicated in multiple inflammatory diseases. This gene is present in a gene cluster on chromosome 3.
Notification