Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNIP2 (NP_775284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNIP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNIP2 (NP_775284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNIP2 |
| Target Synonyms | KCHIP2; KCNIP2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNIP2 (NP_775284.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ | Uniprot ID | Q9NS61 |
Uniprot Id
Q9NS61
Target Species
Human
Target Name
KCNIP2
Target Full Name
A-type potassium channel modulatory protein KCNIP2
Target Function
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart.
Target Subcellular Location
[Isoform 1]: Cell membrane; Lipid-anchor.; [Isoform 2]: Cell membrane; Lipid-anchor.; [Isoform 6]: Cell membrane; Lipid-anchor.
Target Protein Families
Recoverin family
Target Tissue Specificity
Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart.
Target Synonyms
A type potassium channel modulatory protein 2; A-type potassium channel modulatory protein 2; Cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP 2; KChIP2; KCIP2_HUMAN; KCNIP 2; Kcnip2; Kv channel interacting protein 2; Kv channel-interacting protein 2; MGC17241; Potassium channel interacting protein 2; Potassium channel-interacting protein 2
Target Background
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
