-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNJ12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNJ12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05682A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNJ12 |
| Target Synonyms | IRK2; hIRK; IRK-2; hIRK1; KCNJN1; Kir2.2; kcnj12x; hkir2.2x; KCNJ12 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI | Uniprot ID | Q14500 |
Uniprot Id
Q14500
Target Species
Human
Target Name
KCNJ12
Target Full Name
ATP-sensitive inward rectifier potassium channel 12
Target Function
Inward rectifying potassium channel that is activated by phosphatidylinositol 4,5-bisphosphate and that probably participates in controlling the resting membrane potential in electrically excitable cells. Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ12 subfamily
Target Synonyms
KCNJ12; IRK2; KCNJN1; ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+ channel Kir2.2; IRK-2; Inward rectifier K(+ channel Kir2.2v; Potassium channel, inwardly rectifying subfamily J member 12
Target Background
This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Notification