Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B (NP_006609.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KDM5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B (NP_006609.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16446A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM5B |
| Target Synonyms | CT31; PLU1; PUT1; MRT65; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A; 5B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B (NP_006609.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE | Uniprot ID | Q9UGL1 |
Uniprot Id
Q9UGL1
Target Species
Human
Target Name
KDM5B
Target Full Name
Lysine-specific demethylase 5B
Target Function
Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2.
Target Subcellular Location
Nucleus.
Target Protein Families
JARID1 histone demethylase family
Target Tissue Specificity
Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level).
Target Synonyms
Cancer/testis antigen 31; CT31; Histone demethylase JARID1B; JARID1B; Jumonji AT rich interactive domain 1B; Jumonji/ARID domain-containing protein 1B; Kdm5b; KDM5B_HUMAN; Lysine (K) specific demethylase 5B; Lysine demethylase 5B; Lysine specific demethylase 5B; Lysine-specific demethylase 5B; PLU-1; PLU1; PPP1R98; Protein phosphatase 1 regulatory subunit 98; PUT1; putative DNA/chromatin binding motif; RBBP2H1A; RBP2 like; RBP2-H1; Retinoblastoma-binding protein 2 homolog 1; Retinoblastoma-binding protein 2 homolog 1A
Target Background
This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
