-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM5C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human KDM5C (XP_011529128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KDM5C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human KDM5C (XP_011529128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11906A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM5C |
| Target Synonyms | MRXJ; SMCX; MRX13; MRXSJ; XE169; MRXSCJ; JARID1C; DXS1272E; KDM5C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human KDM5C (XP_011529128.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL | Uniprot ID | P41229 |
Uniprot Id
P41229
Target Species
Human
Target Name
KDM5C
Target Full Name
Lysine-specific demethylase 5C
Target Function
Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2.
Target Involvement
Mental retardation, X-linked, syndromic, Claes-Jensen type (MRXSCJ)
Target Subcellular Location
Nucleus.
Target Protein Families
JARID1 histone demethylase family
Target Tissue Specificity
Expressed in all tissues examined. Highest levels found in brain and skeletal muscle.
Target Synonyms
DXS1272E; Histone demethylase JARID1C; JARID1C; JmjC domain containing protein SMCX; Jumonji AT rich interactive domain 1C; Jumonji, AT rich interactive domain 1C (RBP2 like); Jumonji/ARID domain-containing protein 1C; KDM5C; KDM5C_HUMAN; Lysine (K) specific demethylase 5C; Lysine-specific demethylase 5C; MRX13; MRXJ; MRXSCJ; MRXSJ; Protein SmcX; Protein Xe169; rbp2 like protein; Selected cDNA on X; SMCX; Smcx homolog X chromosome; SmcX protein; Smcy homolog X linked; XE169; Xe169 protein
Target Background
This gene is a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. The DNA-binding motifs suggest this protein is involved in the regulation of transcription and chromatin remodeling. Mutations in this gene have been associated with X-linked cognitive disability. Alternative splicing results in multiple transcript variants.
Notification