-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LLGL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 921-1020 of human LLGL2 (NP_001026973.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LLGL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 921-1020 of human LLGL2 (NP_001026973.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07270A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LLGL2 |
| Target Synonyms | HGL; LGL2; Hugl-2; LLGL2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 921-1020 of human LLGL2 (NP_001026973.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE | Uniprot ID | Q6P1M3 |
Uniprot Id
Q6P1M3
Target Species
Human
Target Name
LLGL2
Target Full Name
LLGL scribble cell polarity complex component 2
Target Function
Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.
Target Subcellular Location
Cytoplasm. Note=Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.
Target Protein Families
WD repeat L(2)GL family
Target Synonyms
HGL; Human giant larvae homolog; L2GL2; L2GL2_HUMAN; Lethal 2 giant larvae protein homolog 2; Lethal giant larvae homolog 2; Lethal(2) giant larvae protein homolog 2; LGL2; LLGL2
Target Background
The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification