-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14926A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP5 |
| Target Synonyms | HBM; LR3; OPS; EVR1; EVR4; LRP7; OPPG; BMND1; LRP-5; LRP-7; OPTA1; PCLD4; VBCH2; LRP5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116, Mouse lung, Mouse spleen, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP | Uniprot ID | O75197 |
Uniprot Id
O75197
Target Species
Human
Target Name
LRP5
Target Full Name
Low-density lipoprotein receptor-related protein 5
Target Function
Acts as a coreceptor with members of the frizzled family of seven-transmembrane spanning receptors to transduce signal by Wnt proteins. Activates the canonical Wnt signaling pathway that controls cell fate determination and self-renewal during embryonic development and adult tissue regeneration. In particular, may play an important role in the development of the posterior patterning of the epiblast during gastrulation. During bone development, regulates osteoblast proliferation and differentiation thus determining bone mass. Mechanistically, the formation of the signaling complex between Wnt ligand, frizzled receptor and LRP5 coreceptor promotes the recruitment of AXIN1 to LRP5, stabilizing beta-catenin/CTNNB1 and activating TCF/LEF-mediated transcriptional programs. Acts as a coreceptor for non-Wnt proteins, such as norrin/NDP. Binding of norrin/NDP to frizzled 4/FZD4-LRP5 receptor complex triggers beta-catenin/CTNNB1-dependent signaling known to be required for retinal vascular development. Plays a role in controlling postnatal vascular regression in retina via macrophage-induced endothelial cell apoptosis.
Target Involvement
Vitreoretinopathy, exudative 1 (EVR1); Vitreoretinopathy, exudative 4 (EVR4); Osteoporosis (OSTEOP); Osteoporosis-pseudoglioma syndrome (OPPG); High bone mass trait (HBM); Endosteal hyperostosis, Worth type (WENHY); Osteopetrosis, autosomal dominant 1 (OPTA1); Van Buchem disease 2 (VBCH2)
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Endoplasmic reticulum.
Target Protein Families
LDLR family
Target Tissue Specificity
Widely expressed, with the highest level of expression in the liver and in aorta.
Target Synonyms
BMND1; EVR1; EVR4; HBM; Low density lipoprotein receptor related protein 5; Low density lipoprotein receptor related protein 7; Low-density lipoprotein receptor-related protein 5; LR3; LRP-5; Lrp5; LRP5_HUMAN; LRP7; OPPG; OPS; OPTA1; Osteoporosis pseudoglioma syndrome; VBCH2
Target Background
This gene encodes a transmembrane low-density lipoprotein receptor that binds and internalizes ligands in the process of receptor-mediated endocytosis. This protein also acts as a co-receptor with Frizzled protein family members for transducing signals by Wnt proteins and was originally cloned on the basis of its association with type 1 diabetes mellitus in humans. This protein plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in this gene. Mutations in this gene also cause familial exudative vitreoretinopathy. Alternative splicing results in multiple transcript variants.
Notification