-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against LRP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP6 |
| Target Synonyms | ADCAD2; STHAG7; LRP6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human LRP6 (NP_002327.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSG | Uniprot ID | O75581 |
Uniprot Id
O75581
Target Species
Human
Target Name
LRP6
Target Full Name
Low-density lipoprotein receptor-related protein 6
Target Function
Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor complex recruits DVL1 polymers to the plasma membrane which, in turn, recruits the AXIN1/GSK3B-complex to the cell surface promoting the formation of signalsomes and inhibiting AXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Required for posterior patterning of the epiblast during gastrulation.
Target Involvement
Coronary artery disease, autosomal dominant, 2 (ADCAD2); Tooth agenesis, selective, 7 (STHAG7)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Membrane raft.
Target Protein Families
LDLR family
Target Tissue Specificity
Widely coexpressed with LRP5 during embryogenesis and in adult tissues.
Target Synonyms
ADCAD2; C030016K15Rik; Cd; FLJ90062; FLJ90421; LDL receptor related protein 6; Low density lipoprotein receptor related protein 6; Low-density lipoprotein receptor-related protein 6; LRP-6; LRP6; LRP6_HUMAN; OTTHUMP00000238979; OTTHUMP00000238980; OTTHUMP00000238982; STHAG7
Target Background
This gene encodes a member of the low density lipoprotein (LDL) receptor gene family. LDL receptors are transmembrane cell surface proteins involved in receptor-mediated endocytosis of lipoprotein and protein ligands. The protein encoded by this gene functions as a receptor or, with Frizzled, a co-receptor for Wnt and thereby transmits the canonical Wnt/beta-catenin signaling cascade. Through its interaction with the Wnt/beta-catenin signaling cascade this gene plays a role in the regulation of cell differentiation, proliferation, and migration and the development of many cancer types. This protein undergoes gamma-secretase dependent RIP- (regulated intramembrane proteolysis) processing but the precise locations of the cleavage sites have not been determined.
Notification