Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10362A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRRC4 |
| Target Synonyms | NAG14; NGL-2; LRRC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, Mouse brain, Mouse liver, Rat liver, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI | Uniprot ID | Q9HBW1 |
Uniprot Id
Q9HBW1
Target Species
Human
Target Name
LRRC4
Target Full Name
Leucine-rich repeat-containing protein 4
Target Function
Synaptic adhesion protein. Regulates the formation of exitatory synapses through the recruitment of pre-and-postsynaptic proteins. Organize the lamina/pathway-specific differentiation of dendrites. Plays an important role for auditory synaptic responses. Involved in the suppression of glioma.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic cell membrane.
Target Tissue Specificity
Specifically expressed in brain.
Target Synonyms
LRRC4; BAG; NAG14; UNQ554/PRO1111Leucine-rich repeat-containing protein 4; Brain tumor-associated protein BAG; Nasopharyngeal carcinoma-associated gene 14 protein; Netrin-G2 ligand; NGL-2
Target Background
Predicted to be involved in modulation of chemical synaptic transmission and synapse organization. Predicted to act upstream of or within synapse organization. Predicted to be located in neuron spine and postsynaptic membrane. Predicted to be active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and plasma membrane. Predicted to be integral component of postsynaptic density membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
