Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MANEA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MANEA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01684A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MANEA |
| Target Synonyms | ENDO; hEndo; MANEA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLN | Uniprot ID | Q5SRI9 |
Uniprot Id
Q5SRI9
Target Species
Human
Target Name
MANEA
Target Full Name
Glycoprotein endo-alpha-1,2-mannosidase
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyl hydrolase 99 family
Target Tissue Specificity
Highly expressed in the liver and kidney. Expressed at lower levels in muscle, pancreas, heart, placenta, lung and brain.
Target Synonyms
4932703L02; Alpha 1,2 endomannosidase; DKFZp686D20120; Endo alpha D mannosidase; ENDO; Endo-alpha mannosidase; Endomannosidase; FLJ12838; Glycoprotein endo alpha 1,2 mannosidase; Glycoprotein endo-alpha-1,2-mannosidase; hEndo; Mandaselin; MANEA; MANEA_HUMAN; Mannosidase endo alpha; OTTMUSP0000000508; RP23-424K9.1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
