-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against MCM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-10958A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCM7 |
| Target Synonyms | MCM2; CDC47; P85MCM; P1CDC47; PNAS146; PPP1R104; P1.1-MCM3; MCM7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, HepG2, U-87MG | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG | Uniprot ID | P33993 |
Uniprot Id
P33993
Target Species
Human
Target Name
MCM7
Target Full Name
DNA replication licensing factor MCM7
Target Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
MCM family
Target Synonyms
CDABP0042; CDC 47; CDC47; CDC47 homolog; Cdc47; S. cerevisiae; homolog of; DNA replication licensing factor MCM7; Homolog of S. cerevisiae Cdc47; MCM 2; MCM 7; MCM2; MCM2; formerly; Mcm7; MCM7 minichromosome maintenance deficient 7; MCM7_HUMAN; Minichromosome Maintainence 7; Minichromosome maintainence; S. cerevisiae; homolog of; Minichromosome maintenance complex component 7; Minichromosome maintenance deficient 7; Minichromosome maintenance protein 7; P1.1 MCM3; P1.1-MCM3; P1CDC47; P85MCM; PNAS 146; PNAS146; PPP1R104; Protein phosphatase 1; regulatory subunit 104
Target Background
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification