-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08651A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEK2 |
| Target Synonyms | CFC4; MEK2; MKK2; MAPKK2; PRKMK2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR | Uniprot ID | P36507 |
Uniprot Id
P36507
Target Species
Human
Target Name
MAP2K2
Target Full Name
Dual specificity mitogen-activated protein kinase kinase 2
Target Function
Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. Activates the ERK1 and ERK2 MAP kinases. Activates BRAF in a KSR1 or KSR2-dependent manner; by binding to KSR1 or KSR2 releases the inhibitory intramolecular interaction between KSR1 or KSR2 protein kinase and N-terminal domains which promotes KSR1 or KSR2-BRAF dimerization and BRAF activation.
Target Involvement
Cardiofaciocutaneous syndrome 4 (CFC4)
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Target Synonyms
Cardiofaciocutaneous syndrome; CFC syndrome; CFC4; Dual specificity mitogen activated protein kinase kinase 2; Dual specificity mitogen-activated protein kinase kinase 2; ERK activator kinase 2; FLJ26075; MAP kinase kinase 2; map2k2; MAPK / ERK kinase 2; MAPK/ERK kinase 2; MAPKK 2; MAPKK2; MEK 2; MEK2; Microtubule associated protein kinase kinase 2; Mitogen activated protein kinase kinase 2; Mitogen activated protein kinase kinase 2 p45; MKK 2; MKK2; MP2K2_HUMAN; OTTHUMP00000165826; OTTHUMP00000165827; PRKMK 2; PRKMK2
Target Background
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, cognitive disability, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.
Notification