-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MERTK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MERTK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13781A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MERTK |
| Target Synonyms | MER; RP38; c-Eyk; c-mer; Tyro12; MERTK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTV | Uniprot ID | Q12866 |
Uniprot Id
Q12866
Target Species
Human
Target Name
MERTK
Target Full Name
Tyrosine-protein kinase Mer
Target Function
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including LGALS3, TUB, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.
Target Involvement
Retinitis pigmentosa 38 (RP38)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, AXL/UFO subfamily
Target Tissue Specificity
Not expressed in normal B- and T-lymphocytes but is expressed in numerous neoplastic B- and T-cell lines. Highly expressed in testis, ovary, prostate, lung, and kidney, with lower expression in spleen, small intestine, colon, and liver.
Target Synonyms
c MER; c mer proto oncogene tyrosine kinase; c-mer; cMER ; cmer protooncogene tyrosine kinase ; Eyk; MER; MER receptor tyrosine kinase; MERK; MERPEN ; Mertk; MERTK c-mer proto-oncogene tyrosine kinase; MERTK_HUMAN; MGC133349; nmf12; Nyk; Proto oncogene tyrosine protein kinase MER ; Proto oncogene tyrosine protein kinase MER precursor ; Proto-oncogene c-Mer; Receptor tyrosine kinase MerTK; RP38; STK kinase; Tyrosine-protein kinase Mer
Target Background
This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
Notification