Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MKL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human MKL2 (NP_054767.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MKL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human MKL2 (NP_054767.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03439A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MKL2 |
| Target Synonyms | MKL2; MRTF-B; NPD001 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, LO2, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human MKL2 (NP_054767.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKDPKPRV | Uniprot ID | Q9ULH7 |
Uniprot Id
Q9ULH7
Target Species
Human
Target Name
MRTFB
Target Full Name
Myocardin-related transcription factor B
Target Function
Acts as a transcriptional coactivator of serum response factor (SRF). Required for skeletal myogenic differentiation.
Target Involvement
A chromosomal aberration involving C11orf95 is found in 3 chondroid lipomas. Translocation t(11;16)(q13;p13) with C11orf95 produces a C11orf95-MKL2 fusion protein (PubMed:20607705).
Target Subcellular Location
Nucleus.
Target Synonyms
FLJ31823; Megakaryoblastic leukemia 2; megakaryoblastic leukemia 2 protein; MKL/myocardin-like 2; MKL/myocardin-like protein 2; Mkl2; MKL2_HUMAN; MRTF-B; Myocardin-related transcription factor B; NPD001
Target Background
Enables transcription coactivator activity. Involved in positive regulation of pri-miRNA transcription by RNA polymerase II and positive regulation of striated muscle tissue development. Predicted to be located in cytoplasm. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
