Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MLF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04657A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLF2 |
| Target Synonyms | NTN4; MLF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse brain, Mouse lung, Mouse testis, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS | Uniprot ID | Q15773 |
Uniprot Id
Q15773
Target Species
Human
Target Name
MLF2
Target Full Name
Myeloid leukemia factor 2
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
MLF family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
MLF 2; MLF2; MLF2_HUMAN; Myelodysplasia myeloid leukemia factor 2 ; Myelodysplasia-myeloid leukemia factor 2; Myeloid leukemia factor 2; NTN 4; NTN4
Target Background
Predicted to be involved in regulation of transcription, DNA-templated. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
