-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MOCS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 271-460 of human MOCS3 (NP_055299.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MOCS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 271-460 of human MOCS3 (NP_055299.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02553A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MOCS3 |
| Target Synonyms | UBA4; MOCS3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, Jurkat, Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 271-460 of human MOCS3 (NP_055299.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY | Uniprot ID | O95396 |
Uniprot Id
O95396
Target Species
Human
Target Name
MOCS3
Target Full Name
Adenylyltransferase and sulfurtransferase MOCS3
Target Function
Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
Target Subcellular Location
Cytoplasm.
Target Protein Families
HesA/MoeB/ThiF family, UBA4 subfamily
Target Synonyms
Adenylyltransferase MOCS3; dJ914P20.3; MGC9252; MOCS 3; MOCS3; MOCS3_HUMAN; Molybdenum cofactor synthesis 3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; Molybdopterin-synthase sulfurtransferase; MPT synthase sulfurylase; Sulfur carrier protein MOCS2A adenylyltransferase; Sulfur carrier protein MOCS2A sulfurtransferase; Sulfurtransferase MOCS3; UBA 4; UBA4 ubiquitin activating enzyme E1 homolog; UBA4
Target Background
Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
Notification