-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MORF4L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MORF4L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02702A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MORF4L1 |
| Target Synonyms | Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15; MORF4L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, MCF-7, Mouse brain, Mouse spleen, Mouse testis, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MORF4L1 (NP_006782.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG | Uniprot ID | Q9UBU8 |
Uniprot Id
Q9UBU8
Target Species
Human
Target Name
MORF4L1
Target Full Name
Mortality factor 4-like protein 1
Target Function
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.
Target Subcellular Location
Nucleus.
Target Synonyms
CG6363; Eaf3; Esa1p associated factor 3 homolog; FWP006; HsT17725; MEAF3; MO4L1_HUMAN; MORF related gene on chromosome 15; MORF-related gene 15 protein; Morf4l1; MORFRG15; Mortality factor 4 like 1; Mortality factor 4 like protein 1; Mortality factor 4-like protein 1; MRG15; Protein MSL3-1; S863-6; Transcription factor-like protein MRG15
Target Background
Enables protein N-terminus binding activity. Involved in double-strand break repair via homologous recombination and histone modification. Located in nuclear speck. Part of NuA4 histone acetyltransferase complex and Sin3 complex.
Notification