Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-292 of human MRPL19(NP_055578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against MRPL19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-292 of human MRPL19(NP_055578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?MRPL19 in paraffin-embedded?rat liver tissue using?MRPL19 Rabbit pAb at a dilution of 1:200 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08488A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL19 |
| Target Synonyms | RLX1; L15mt; L19mt; bL19m; MRPL15; RPML15; MRP-L15; MRP-L19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 181-292 of human MRPL19(NP_055578.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKEIEASKRS | Uniprot ID | P49406 |
Uniprot Id
P49406
Target Species
Human
Target Name
MRPL19
Target Full Name
Large ribosomal subunit protein bL19m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bL19 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
MRPL19; KIAA0104; MRPL15; 39S ribosomal protein L19; mitochondrial; L19mt; MRP-L19; 39S ribosomal protein L15; mitochondrial; L15mt; MRP-L15; Mitochondrial large ribosomal subunit protein bL19m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
