-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPS7 (NP_057055.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPS7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPS7 (NP_057055.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS7 |
| Target Synonyms | MRPS7; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt; bMRP27a; mitochondrial ribosomal protein S7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F, A-431 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPS7 (NP_057055.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN | Uniprot ID | Q9Y2R9 |
Uniprot Id
Q9Y2R9
Target Species
Human
Target Name
MRPS7
Target Full Name
Small ribosomal subunit protein uS7m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uS7 family
Target Synonyms
28S ribosomal protein S7; 28S ribosomal protein S7, mitochondrial precursor; 30S ribosomal protein S7 homolog; bMRP 27a; bMRP-27a; bMRP27a; mitochondrial; Mitochondrial ribosomal protein S7; MRP S; MRP S7; MRP-S7; MRPS; mrps7; RP S7; RPMS7; RPS7; RT07_HUMAN; S7mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p.
Notification