-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSRB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-182 of human MSRB2 (NP_036360.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MSRB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-182 of human MSRB2 (NP_036360.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09062A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSRB2 |
| Target Synonyms | CBS1; MSRB; PILB; CBS-1; CGI-131; MSRB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-182 of human MSRB2 (NP_036360.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH | Uniprot ID | Q9Y3D2 |
Uniprot Id
Q9Y3D2
Target Species
Human
Target Name
MSRB2
Target Full Name
Methionine-R-sulfoxide reductase B2, mitochondrial
Target Function
Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.
Target Subcellular Location
Mitochondrion.
Target Protein Families
MsrB Met sulfoxide reductase family
Target Tissue Specificity
Ubiquitous. Detected in retina, ocular ciliary body, skeletal muscle, heart, colon, bone marrow, cerebellum, small intestine, fetal brain, fetal liver, kidney, spinal cord, lung, placenta and prostate.
Target Synonyms
CBS 1; CBS1; CGI 131; Methionine sulfoxide reductase B2; Methionine-R-sulfoxide reductase B2; MGC26104; mitochondrial; MSRB 2; MSRB; Msrb2; MSRB2_HUMAN; PILB; Pilin like transcription factor
Target Background
Predicted to enable actin binding activity; peptide-methionine (R)-S-oxide reductase activity; and zinc ion binding activity. Predicted to be involved in actin filament polymerization and protein repair. Predicted to be located in mitochondrion. Predicted to be active in cytoplasm.
Notification