-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTCH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MTCH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15900A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTCH2 |
| Target Synonyms | MIMP; HSPC032; SLC25A50; H2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGI | Uniprot ID | Q9Y6C9 |
Uniprot Id
Q9Y6C9
Target Species
Human
Target Name
MTCH2
Target Full Name
Mitochondrial carrier homolog 2
Target Function
The substrate transported is not yet known. Induces mitochondrial depolarization.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Synonyms
MTCH2; MIMP; HSPC032; Mitochondrial carrier homolog 2; Met-induced mitochondrial protein
Target Background
This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons.
Notification