Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTMR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MTMR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type(WT) and MTMR3 knockdown (KD) 293T(KD) cells, using MTMR3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-10942A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTMR3 |
| Target Synonyms | ZFYVE10; FYVE-DSP1; [KD Validated] MTMR3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T(KD) | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL | Uniprot ID | Q13615 |
Uniprot Id
Q13615
Target Species
Human
Target Name
MTMR3
Target Full Name
Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR3
Target Function
Phosphatase that acts on lipids with a phosphoinositol headgroup. Has phosphatase activity towards phosphatidylinositol 3-phosphate and phosphatidylinositol 3,5-bisphosphate. May also dephosphorylate proteins phosphorylated on Ser, Thr, and Tyr residues.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class myotubularin subfamily
Target Synonyms
FYVE domain-containing dual specificity protein phosphatase 1; FYVE-DSP1; MTMR3; MTMR3_HUMAN; Myotubularin-related protein 3; Zinc finger FYVE domain-containing protein 10
Target Background
This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3, 5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
